PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun008257
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 277aa    MW: 30833 Da    PI: 4.5289
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-13753PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox19.12.2e-061011124556
                HHHHHHHHHHHH CS
   Homeobox  45 kvWFqNrRakek 56 
                 vWFqNrRa++k
  Vun008257 101 AVWFQNRRARWK 112
                59*********9 PP

2HD-ZIP_I/II66.46.3e-22891493292
  HD-ZIP_I/II  32 lareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  + +e g+ ++  avWFqnrRAR+ktkqlE+d+++Lk++yd+l ++ ++L ke+e+L++e+ 
    Vun008257  89 VGQEAGIATQAGAVWFQNRRARWKTKQLERDFDVLKSSYDTLLASYDSLMKENEKLKSEVV 149
                  566778888888*********************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-6101121IPR009057Homeodomain-like
CDDcd000860.00123102115No hitNo description
SuperFamilySSF466898.76E-5102125IPR009057Homeodomain-like
PfamPF021834.6E-18114156IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
XGSPANISPA TPTTVFAVFL GPETEARKGR TWVVGRIWRC MMGSCICPLE TPARLLWTTS  60
FFRHKLXDLL IIPTPKKKLS NNINNNDPVG QEAGIATQAG AVWFQNRRAR WKTKQLERDF  120
DVLKSSYDTL LASYDSLMKE NEKLKSEVVS LNEKLQVQAK EVPEEPLYDK KVDPLPVEDI  180
ASIFSTRVED HQSSGSVGSA VVDEGSPQLV VDSVDSHFPA DNPGGCVGPV ERVQSEEEDG  240
SDDGRSYMDV FVVSETENQN HEEGEGLVWW TNMYYVG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1106114RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014515876.11e-125PREDICTED: homeobox-leucine zipper protein HAT5
TrEMBLA0A0L9VP071e-125A0A0L9VP07_PHAAN; Uncharacterized protein
STRINGGLYMA13G23890.31e-111(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-42homeobox 1